Quiet essentials · Free shipping over $75 · Shop the edit

BMP6 Polyclonal Antibody-BS71167 Size:100µl Gene Name: IL20RB

SKU: 41952957720

4.0
USD167.44 USD198.44

Pay in 4 interest-free payments of $41.86 Learn more

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 8 - Aug 13

Description

Gene Name: IL20RB

Specificity: NCS1 Antibody detects endogenous levels of total NCS1

Immunogen: Purified recombinant fragment of human FOS expressed in E

VTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAAT

BMP6 Polyclonal Antibody-BS71167 Size:100µl Gene Name: IL20RBBMP6 Polyclonal Antibody Sizes: 50 l, 100 l Catalogue Numbers: BS71167 50, BS71167 100 Product: 1mg ml in PBS with 0. 02% sodium azide, 50% glycerol, pH7. 2 Swiss Prot: P22004 Host: Rabbit Reactivity: Human, Mouse, Rat Applications: WB All Applications: WB,1: 500 1: 2000 Background: The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth

Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

You may also like

recommand products